PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1827
Common NameSPL11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 476aa    MW: 52597.9 Da    PI: 7.8316
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1827genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-41188265178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC+ dls+a++yhr+hkvCe hsk+p+v+vsgle+rfCqqCsrfh+lsefD +krsCrrrL++hn+rrrk+q+
  Gh_D04G1827 188 RCQVEGCNLDLSSARDYHRKHKVCESHSKSPKVIVSGLERRFCQQCSRFHALSEFDVNKRSCRRRLSDHNARRRKPQT 265
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-32183250IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.419186263IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.44E-39187268IPR004333Transcription factor, SBP-box
PfamPF031102.3E-31189262IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MSFISLMEWN EQTPLQWDWE NLMLNATPTE IPRRLRPVEW GIDEGEGGLD SVSLNSSSVA  60
GGSGGSGSDL GLASLSKNLK SASIDSLSMG EAKLTKFTLD AYEAIPDDIS NKKEVSGIET  120
TSTSLTLVAS VGSGEPLLSL KLGKQTFSED FSTGTNATDS SYSATLSTSS PLSAKRSKLN  180
CRSTHVVRCQ VEGCNLDLSS ARDYHRKHKV CESHSKSPKV IVSGLERRFC QQCSRFHALS  240
EFDVNKRSCR RRLSDHNARR RKPQTEATHF NAARISSSYD GKQHTSFVWN EVPILHNVRP  300
KKKFAMEGTF YSKSSRMTSY MPMKLGNINE QVQLPINQLS NPVMMRCNDF NKFLPSKGKQ  360
NTAEVLDGGV EQSMVASSTG TAQELHRALS LLSNDPQVSS EPKHGSLTYP IMHVDPTSTS  420
QPAMNAIPQG FQHALPENWQ IGQQEETSTE SRMHTSDVDN RFREFLLLKA PYDGGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271892621184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.35400.0boll| leaf| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223190.0KJ622319.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458631.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458630.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458629.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458628.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458627.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458626.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012458624.10.0PREDICTED: squamosa promoter-binding-like protein 2
TrEMBLA0A088DKA20.0A0A088DKA2_G
STRINGVIT_01s0010g03710.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.37e-66squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]